PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G201600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 415aa    MW: 44744.8 Da    PI: 6.7088
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G201600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.6e-1998144148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT+eEd  l  av+q+G + W+ Ia++++ gR +kqc++rw ++l
  Brast08G201600.1.p  98 KGTWTQEEDNMLRAAVNQFGERKWAVIAKHLP-GRIGKQCRERWINHL 144
                         799*****************************.************996 PP

2Myb_DNA-binding51.22.9e-16150192145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         +++W++ E++ lv+a+k  G++ W+ Iar+++ gR+++++k++w+
  Brast08G201600.1.p 150 KDPWSEAEELELVNAHKTCGNK-WSVIARRLP-GRSENNVKNHWN 192
                         689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.06293148IPR017930Myb domain
SuperFamilySSF466898.61E-3096191IPR009057Homeodomain-like
SMARTSM007173.8E-1897146IPR001005SANT/Myb domain
PfamPF002492.1E-1798144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2699151IPR009057Homeodomain-like
CDDcd001679.29E-17100144No hitNo description
SMARTSM007172.9E-13149197IPR001005SANT/Myb domain
PROSITE profilePS5129416.117149199IPR017930Myb domain
PfamPF002492.9E-14150192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-19152194IPR009057Homeodomain-like
CDDcd001671.40E-11152192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MAAGHEFFAD LELAAAMERA AAGNYFSLAS SSLGGVAAAQ FFPNNSVAPA DIGSATRGGH  60
GTMAPVNFAF GGSALPVQAA VVPPAPPLPD AEDVGQLKGT WTQEEDNMLR AAVNQFGERK  120
WAVIAKHLPG RIGKQCRERW INHLHPDIKK DPWSEAEELE LVNAHKTCGN KWSVIARRLP  180
GRSENNVKNH WNATRRGLGA KRFLKKRSSQ RQPAPGRLSH LAHYIRTIHP PPPSAAAASL  240
SPPPPPEQEN EEQQLQAPQV DAVEEQDHLA AGNGENGSSA TAEVLGDEFS YYFTHMQVPQ  300
QQQQVQQRQM MNYNMSYNVY PPLTAEDYQI QMGLNRMYAA QQAAQDRGSS SNNARLDGVL  360
MGNNAVGGGG FSSYGYGGGV GPSGVGVNVA QFAAEPGQYQ VFNLEDHLTR FPSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-38971963102C-Myb DNA-Binding Domain
1msf_C2e-38971963102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.11e-57PREDICTED: uncharacterized protein LOC101784221
TrEMBLA0A0Q3J3W10.0A0A0Q3J3W1_BRADI; Uncharacterized protein
STRINGSi004755m4e-57(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-43myb domain protein 98